PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03876.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 284aa    MW: 32609.3 Da    PI: 6.7165
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03876.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.93.4e-4861323128
                      NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                              pGfrFhPt+eelv +yLk+kv gkkl+  +vi  ++iy+++PwdLp  ++ +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+
  Sme2.5_03876.1_g00003.1   6 PGFRFHPTEEELVEFYLKNKVLGKKLRG-DVIGVLNIYRHDPWDLPGLATIGEREWYFFVPRDRKHGSGGRPNRTTQKGFWKATGS 90 
                              9**************************9.99***************8777899********************************* PP

                      NAM  89 dkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              dk+++     ++ +glkktLvfy+grap+g+ktdWvm+e+rl
  Sme2.5_03876.1_g00003.1  91 DKKIFGLshPKSMIGLKKTLVFYTGRAPRGSKTDWVMNEFRL 132
                              ****976556778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.1294151IPR003441NAC domain
SuperFamilySSF1019416.8E-565151IPR003441NAC domain
PfamPF023657.2E-276132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEVDLPGFRF HPTEEELVEF YLKNKVLGKK LRGDVIGVLN IYRHDPWDLP GLATIGEREW  60
YFFVPRDRKH GSGGRPNRTT QKGFWKATGS DKKIFGLSHP KSMIGLKKTL VFYTGRAPRG  120
SKTDWVMNEF RLPDTYSVPH HDIVLCKIYR KATPLKVLEQ RAAIEEEMNT TKHVDYGSPC  180
SITQPTDTMS FCSELMAASI TDQSSEFLMP IAKDEVEDDI LSITENNVYQ VSAEIKGKTN  240
CYELAELQVP KFNMDFSQDP IWMQLRSPWL DNFCLTPSAF VHNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-48615117168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544591.11e-174PREDICTED: NAC domain-containing protein 67
TrEMBLM1AQT61e-166M1AQT6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000281901e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35312248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.12e-99NAC domain containing protein 36